SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|132015|estExt_Genewise1Plus.C_170056 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|132015|estExt_Genewise1Plus.C_170056
Domain Number - Region: 241-334
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.034
Family Myosin rod fragments 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|132015|estExt_Genewise1Plus.C_170056
Sequence length 493
Sequence
MSVSLGSPYSPIRPTSRSSSRNSNRSFRTHSPSLSPSLSSDDPVAVRNQISTLRHSIRLQ
QAQLHSLEDIILAGPRPLPLGFMMPLSPGTTTQDDSVLDISPYPAPGTPKMQRRNSHDHL
QGLAGRDSGLPLPLQQDGIREGVPTDFGTPSKDAMRRQHSLDRSLSRIPVSSVGNARALA
EEGNPANRGMSPTPPSPSGRDGGRLSVMSPTGQPSSPNKRLSFTPGGTTRVLADLQTGVI
NARNALENTKSQLRLSQRTVAQLTRQTEDLKESRERLRLENEGLNNVVARKERLLQEVLE
RARKAEAEAASMKSQLKTETSASKKSLREMEASLAESTALSQKSEREYVTLRDSIKSMAE
GWKVDTERLREEMRRREDMLKKEAEMMGQKYQRLVAEVRAADGQRESMRELKHAHENIRK
EAEDCFRLEIGQLRTQTEEFSKKSDESNQIAKCLASELARLRRLMQAAGRSPPQSMIMDD
SAPDVSASADGSS
Download sequence
Identical sequences XP_007774517.1.51617 jgi|Conpu1|132015|estExt_Genewise1Plus.C_170056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]