SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|133409|estExt_Genewise1Plus.C_230031 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|133409|estExt_Genewise1Plus.C_230031
Domain Number 1 Region: 4-82,131-188
Classification Level Classification E-value
Superfamily DNA-glycosylase 3.14e-26
Family Mismatch glycosylase 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|133409|estExt_Genewise1Plus.C_230031
Sequence length 219
Sequence
MIQEEFAADPWKLLVATVFLNKTWGRNAIPTFRKVLERWPTPKDLMEADTDELVAMIQKL
GLQSTRAIRLKELSRAYHEHPPRTGTLQLEHGKFARAPASLRERYPPELPSTCDSEADVS
LALGGEAWPYPKTPISHLPGVGRYGWDSYRIFCTDNVTGTGSSDEWKRVQPSDKELCRYL
TWRWAYEEGRMWASDVGPCGPVCEEWLQHQIRDELPRKA
Download sequence
Identical sequences R7SG25
XP_007775756.1.51617 jgi|Conpu1|133409|estExt_Genewise1Plus.C_230031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]