SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|133816|estExt_fgenesh1_pm.C_1_t10225 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|133816|estExt_fgenesh1_pm.C_1_t10225
Domain Number 1 Region: 1727-1850,1882-2027
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.75e-30
Family Nucleotide and nucleoside kinases 0.076
Further Details:      
 
Domain Number 2 Region: 1392-1676
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.65e-24
Family Extended AAA-ATPase domain 0.046
Further Details:      
 
Domain Number 3 Region: 723-947
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.13e-22
Family Extended AAA-ATPase domain 0.09
Further Details:      
 
Domain Number 4 Region: 978-1191
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000458
Family Extended AAA-ATPase domain 0.084
Further Details:      
 
Weak hits

Sequence:  jgi|Conpu1|133816|estExt_fgenesh1_pm.C_1_t10225
Domain Number - Region: 2235-2316
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00118
Family Myosin rod fragments 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|133816|estExt_fgenesh1_pm.C_1_t10225
Sequence length 3454
Sequence
MEAFGSPNSSTAQAVTFITFVQDLKRKTKTWGPMIELCANGEKTLERFRYQFPDDWLYSD
QLKGEWSAFNEILKRKNDSIQEQLAGLQLKIVAEDKIVENKINDILNEWEQTRPVQGNMR
ADTAMNTINVFEGKLTRVQEEYDLVCRAKEALDLELTRHTRLEPVFEELRDLKAVWTALS
GVWSQINELRELSWATVQPRKLRQQIDGLLTSTKEMPTRMRQYAAFEYVQDQLRGLLKSN
SVVSDLKSEALKDRHWKQLFKNLRLPAAISLTLMTLGHVYDLDLKKNESLIREVIIQAQG
EMALEEYIKQVKEVWSNYTLELVNYQNKCRLIRGWDDLFNKCSENLNSLTAMKLSPYYKV
FEEEASSWEEKLNRIHVLFDVWIDVQRQWVYLEGIFSGSADIKHLLPVESARFQNINSEF
LTVMKKVYKSPFVIDVMNIQGIQKSLERLADLLNKIQKALGEYLERERSSFPRFYFVGDE
DLLEIIGNSKDILRIMKHLKKMFAGISTIRLDEGLTEIQGMASREGEEVKFNTPISLKEY
PKINDWLAKLEATMRVSLAELLCEAVSELQMFYGLSSGLPKDQLMAWLEKYPAQLVTLVI
QVAWTTSVEASFAERQTPTGPLETVSQALDLLADIVLQELSPVTRRKCEHLITELVHQRD
VTRALIQQNIVDSKAFVWLSQMRYYLDNAIEQPLDRLAVRVADATFPYGWEYLGVPDRLV
QTPLTDRVYLTLTQALDSQLGGSPFGPAGTGKTESVKALGVQLGRFVLVFCCDETFDFQA
MGRIFVGLCQVGAWGCFDEFNRLEERILSAVSQQVQSIQQGLASLVKNPNTEIELVGKTL
RINKNIGIFITTNPNYAGRSQLPPNLTKLFRPMAMTRPDRELIAQVMLFSQGFRTAESLA
SKIVPFFNLCDEQLSPQPHYDFGLRALKAVLASAGILKRERLQAVRDSEEEAPEAEGLSD
TISEQIIVIQSVTETIVPKLVADDVPLLTSLLADVFPGTEYEPVDLGALREEILKVCAER
RLVDGERWIAKILQLYQIQKIQHGLMMVGSSGSGKTNAWQVLLAALERLDGTEGIAYVID
PKAMHKDALYGTLDQTTREWNDGLFTHILRKIVDDVRGESGKRHWIIFDGDVDPEWVENL
NSVLDDNKLLTLPNGERLNLPPNVRIMFEVEHLRYATLATVSRCGMIWFSEDVIDPAMVY
QHYLSTLSTVPLDASDEDAADVLGRRADASEATSAHLETQKQIASNLERYFADGELVSSA
LSYAESIEHIMDFTAARALETLFSLLNKTARNIIEYNMQHTDFPLSAERVEQYVTKRLLV
SIIWAFSGDAKLDLRAQMGEFLCKQTGIDLPPLGPGASLIDYDVQIANGEWVAWQSKVPV
IEIEAQSVTASDIVVPTMDTVRHEEVLYSWLSEHKPLMLCGPPGSGKTMTLFSALRKLPD
MEVVGLNFSSATTPELILKTFEQYCEYRKTPNGVILAPVQIGRWLVVFCDEINLPAQDKY
GTQRVISFLRQLVECGGYWRSSDMAWVTLERIQFVGACNPPTDPGRVPLSHRFLRHAPLV
MVDYPGELSLKQIYGTYSRALLKVVPTLRAYAEPLTDAMVAFYLDSQKRFTADIQAHYVY
SPRELTRWVRGIYEAIRPLEILSVEGLVRVWAHEALRLFQDRLVTEEERQWTDEHINNAA
MENFPTINQEESLKRPILFSNWTSKNYIPVDREELREYTKARLKVFYEEELDVPLVLFND
VLDHVLRIDRVFRQVQGHLLLIGVSGSGKTTLSRFVAWLNGLSIFQIKVSNKYTGDDFDE
DLRTVLRRAGTKGEKICFIMDESNVLDSGFLERMNTLLANAEVPGLFEGDEHAALMTACK
EGSQRDGLMLDSHEELYRWFTQQVAKNLHVVFTMNPPENGLASRAATSPALFNRCVLDWF
GDWSDQAFYQVGMEFTHTLDLDLPSYSPPDHFPIAYRELSLPPSHRNAVVNALVYVHSSL
HAINQRLSRRQGRYNYVTPRHYLDFINHYVKLYNEKREELEEQQRHLHVGLDKLKDTVTQ
VEELRKSLAIKRTQLQAKDAEANEKLKRMVSDQQEAEQKKAASIEIQAALVEQDKHIAQR
KEVVMADLADAEPAVLEAQAAVGNIKKQHLQEVRAMANPPEAVKLAMESVCTILGHKIDS
WRTVQGIIRRDDFIQRIVNFDTNAQMTKPLRDLMKREFLSRPSYNFEMVQRASKACGPLV
KWALAQVRFSEILDKIEPLRNEVQSLEDQADTTKKQASQIITMISELESKIATYKDEYAL
LISETQAIKSEMERVQNKVDRSMKLLESLSSEKGRWEDGSRTFDAEMSTIVGDVLLSAAF
LAYGGFFDQHYREVMWQDWSGHLSEANVKFKSELSLTEYLSTADDRLSWQSKSLPADNLT
TENAIMLKRFNRYPLIIDPTGQATTFLLNEYKDRKIAVTSFLDEAFLKVLESALRFGNPL
LIQDVENLDPILNAVLNKEIRRTGGRVLIRLGNQDIDFSPSFTMFLSTRDPSVEFSPDVC
SRVTFVNFTMTRSSLQSQSLDQVLKVERPDTERKRTDLMKAQGEFRLRLRTLEKLLLQAL
NESTGNILDDDKVISTLETLKREAAEITRKVEETDVVMREVEEVTAEYLPLAQACSAVFF
ILEQLNLVNHFYQFSLRFFLDIFDYVLHHNPNLAGVTDHHRRREILLSDLFVVVFKRTSR
ALFYRDHVMLAVLLSQVKLRGVEEIADELEYLLEAGQGVTPGLIPTQKSPVLSDDQMVTL
EHYAKNSIFKPVLNHVMERPEEWAPFIQSETPETSVPMPWDPSTPAVEAIRAMLIIKCLR
PDRLLQATALLVRSVFHDELSAALDLGAMVNDEVPPATPVGLVSVTGYDASYRVENLIQT
NNVRSASVAMGSQEGFALADQAIAAAARQGTWVLLKNVHLAPTWLGQLEKKLQTLNPHRN
FRLFLTMEANPSIPVNILRQSRLIMNEPPPGIKANLLDSLRSIAPMRLSQGPAEKSRLYF
LLAWFHAVVQERLRYVPLGWSKMYDFNDSDMASAFGTIDTWLNSVAKGRANVDPATIPWD
ALRTLIKQSVYGGRVDSEFDQRILDSFVDKLFTPMAYNVDFSLVPSVDGTVLEGPDGTKV
EHFLDWVRKLPDREPPSWLSLPPTAERVIAIAQGNELLGKLRKMRMLSDDDDEVGASGPS
KGQGVQQPAWMRQLFERSREWLAQLPSKLNVLPKQASEKSDPLYRFFSREGTIGQKLLGQ
VRKDLESVIKVCEGELKQTNHLRTLMSSLTKGTIPNHWRKYKVPKVMSVSECIPDLSRRL
AQLEEIVTMQQNLPHVEVWLGGLFFPEAYITATRQAVAHRKRWSLETLHLRLEIGEVKNP
EAFMIDGLSLEGASWNVELRKLGLNDGQSVRLNPSQIRWVQIDPETPEDKTGLVTLPVYL
NNDRSDVMFSVDLPFDDGDAALVAMRAVCLTARG
Download sequence
Identical sequences jgi|Conpu1|133816|estExt_fgenesh1_pm.C_1_t10225 XP_007763208.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]