SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|133881|estExt_fgenesh1_pm.C_1_t10299 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|133881|estExt_fgenesh1_pm.C_1_t10299
Domain Number 1 Region: 5-531
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 3.93e-211
Family Heme-dependent catalases 0.000000000178
Further Details:      
 
Domain Number 2 Region: 537-691
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 1.87e-22
Family Catalase, C-terminal domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|133881|estExt_fgenesh1_pm.C_1_t10299
Sequence length 726
Sequence
MTPTSKIADLERDIQEPRTGPSLTTDSGQKVSNTDTWLKVANDKQGGPALLEDQHGREKI
HRFDHERIPERVVHARGAGAHGYFKPFNDAAAKYTFAPVLTDPARTTPVFIRFSTVQGSR
GSADTVRDVRGFAVKFYTEEGNWDIVGNDIPVFFIQDAIKFPDFVHAVKPEPHNEVPQGQ
SAHNNFWDFVGLQPEATHMVMWVMSDRGIPRSFRMMQGFGVNTYTLQNAKGERHFVKFHF
VPELGVHSLVWDEALKICGQDPDFHRKDLHEAIDNGVYPKWTMRIQVIPEADEHKFDFDI
LDATKIWPEELVPLIDVGELVLNRTVDEFFTETEQVAFCTSHIVPGIGFSDDPLLQGRNF
SYFDTQITRLGINWEELPINRPVCPVMNNQRDGAMRHRIVKGDINYWPNRKDFNRPVPPQ
EGGYLEYAQKVEGIKQRARGPKFQEHYSQAQLFYNSLAPHEQTHLMNAIGFELSHCDDPV
VYKSYMDVLQNVDMDLAKSIALKVDGKLPEKTHRPNHGRTSHGLSQGDFAPKNPTIASRR
IAILIADGFDAAEVKAVKTALTKAKALCFIIGPRRNEIKPAQDIGEKIIADHHFEGQRST
LFDAIYIPSGAEHIKTLSKNGRVVHWVREAFGHLKPIAAVGEAVNFLRDVVRLPNVKLFA
PSTGEGEVVSDYGVVTTGQYSAPTEVAAAFSMAKQDHSFVGNFAQNISRHRIWEREQDGL
TEMVAY
Download sequence
Identical sequences XP_007763262.1.51617 jgi|Conpu1|133881|estExt_fgenesh1_pm.C_1_t10299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]