SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|134604|estExt_fgenesh1_pm.C_2_t10007 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|134604|estExt_fgenesh1_pm.C_2_t10007
Domain Number 1 Region: 4-81
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 4.25e-23
Family LSM14 N-terminal domain-like 0.00092
Further Details:      
 
Weak hits

Sequence:  jgi|Conpu1|134604|estExt_fgenesh1_pm.C_2_t10007
Domain Number - Region: 80-151
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0471
Family beta-sandwich domain of Sec23/24 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|134604|estExt_fgenesh1_pm.C_2_t10007
Sequence length 364
Sequence
MALSFIGKPISLISHSDVRYRGILAGIDPAASTIQLSNVFSMGTETRKPPAEYIPPVQEP
YQYIIFRASEVKDLAVDEPVPPPQPHRSVHDDPAVLGASAPAPAPYGAYPPGFQPPAPAQ
QPPQPPPPQQYAQAAAAAAGRPGPGPGPAPDAQPRRGGPNNTGSIHTAAASLETVERALG
DLRVQNGGGGGAPRGGGRGGRRGHGSGGAHEKTEIRVPTTDFDFQGSNARFDKAALGPKK
SPVADEERAPDDKPAEVVDSNDAVGKADGAKKDDGAYNPTRSFFDSLSSSTQGPDGPPGG
GGRGGRRGGGRNRREEERERNVATFGEPGGVGLMGPGAYVGGWGGHGRRGGRGPRRGGAA
VAGR
Download sequence
Identical sequences XP_007764370.1.51617 jgi|Conpu1|134604|estExt_fgenesh1_pm.C_2_t10007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]