SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|135134|estExt_fgenesh1_pm.C_2_t20094 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|135134|estExt_fgenesh1_pm.C_2_t20094
Domain Number 1 Region: 122-227
Classification Level Classification E-value
Superfamily Siroheme synthase middle domains-like 7.85e-25
Family Siroheme synthase middle domains-like 0.0019
Further Details:      
 
Domain Number 2 Region: 13-126
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 5.91e-17
Family Siroheme synthase N-terminal domain-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|135134|estExt_fgenesh1_pm.C_2_t20094
Sequence length 279
Sequence
MPADISSLTGGSLLVAWQLKDKHVLIVGGGDVASGRIESVLAADARITLICPSSGLHPLT
KRFIEATDRITYCDRVFAAEDDLVGVDMALTAIDQVEESRRVCALCREHKIPVNVADIPE
SCDFYFGSQIRDGPLQVLISTNGQSPKLANIIRKRVEQALPNCAGDAISKVGELRTKLKE
RAPGVGGELGKRRMRWMIDICTSWEMEDLALMDSPMMDRLLDDGWEQNVTPNPDQFKALR
GRRSGSASHATSASGVLLPILAFATGVICSGLWMSQRVR
Download sequence
Identical sequences XP_007764873.1.51617 jgi|Conpu1|135134|estExt_fgenesh1_pm.C_2_t20094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]