SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|135447|estExt_fgenesh1_pm.C_3_t10064 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|135447|estExt_fgenesh1_pm.C_3_t10064
Domain Number - Region: 44-94
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000357
Family Classic zinc finger, C2H2 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|135447|estExt_fgenesh1_pm.C_3_t10064
Sequence length 114
Sequence
MTASRSVKRERSQSQSLHDSNSVTSCDSDGDGLPQAKRRRGGYVCGLDGCKRVCGTAGDL
RRHHQSLRHGPPEFRCLACKQTFTRLDALRRHLKLKAACRRVHNRLEAQAVTIS
Download sequence
Identical sequences XP_007765612.1.51617 jgi|Conpu1|135447|estExt_fgenesh1_pm.C_3_t10064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]