SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|135698|estExt_fgenesh1_pm.C_3_t10341 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|135698|estExt_fgenesh1_pm.C_3_t10341
Domain Number 1 Region: 21-84
Classification Level Classification E-value
Superfamily Chaperone J-domain 4.32e-26
Family Chaperone J-domain 0.00036
Further Details:      
 
Domain Number 2 Region: 315-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000228
Family Classic zinc finger, C2H2 0.06
Further Details:      
 
Weak hits

Sequence:  jgi|Conpu1|135698|estExt_fgenesh1_pm.C_3_t10341
Domain Number - Region: 503-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0771
Family Classic zinc finger, C2H2 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|135698|estExt_fgenesh1_pm.C_3_t10341
Sequence length 546
Sequence
MGAQESRAPNGQDAQQDQGVSDYYELLGVEESATDDEIKRAFRKLALVHHPDKNQNDVEG
ATKRFAAIQQAYEVLSDEQERAWYDSHKASLEPEPDADVIFEEIRRGAPARRARDRGLTT
RHLQQFMDPKIWSGFDDGADSFFTLYRNLFDRLGQEEAAISGIEYPSFGYSTWTWAGASK
DSEDAARWFYSAWSNFTSSKEFTWMEQWNVNDAPDRRVRRSMEQDNKKARDDARKDFNEA
VKDLAAFLRKRDPRHKAHQVRQKQLNEAKASGSSTPNKVPKASPKPIPEYVEQEWQRVSR
REGEDDLEWAAGEGENPEDYECVACNKTFRSEAAWSSHERSKKHLKEIEKLKRMMQEDND
ELGLDPDAGTDGLGGNDDSQIGTDEGFETPVGRKSSLDPSEQLYPPVDDPSPTLKPKDST
RQNVGSGQKPPKKKTRKGQKTPVENVAKIADKDDARGSDIEVVKITENFEKIVEVDTTPQ
LSKREKRKLREARKAEAESKPELTCNFCKGGFENKSKLFAHLKETGHTTAVSDDAPTART
KKKGRK
Download sequence
Identical sequences XP_007765930.1.51617 jgi|Conpu1|135698|estExt_fgenesh1_pm.C_3_t10341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]