SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|135940|estExt_fgenesh1_pm.C_4_t10005 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|135940|estExt_fgenesh1_pm.C_4_t10005
Domain Number 1 Region: 30-291
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.09e-89
Family Crotonase-like 0.000000194
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|135940|estExt_fgenesh1_pm.C_4_t10005
Sequence length 292
Sequence
MASRSLLTSSILRHQSRTLVRGRSAFARFYSEQRYENILTSRPDPGVALITLNRPKALNA
LSTAHFRDILSALNDADADEKVGAIVLTGSEKAFAAGADILEMKDKTYADAYGNNFLSNW
EDLKKIRKPIIAAVSGYALGGGCELALSCDIILASPTAKFGQPEINLGVIPGGGGTQRLT
RAVGKARAMELMLTGRMFNAQEAERWGVVAKVVEEGEGKVLEEAVGMAKAIASKGRLAVM
ATKEAVNAAYEMPLTEGLRFERRLFHGLFATNDQKEGMAAFAEKRKPNFTDS
Download sequence
Identical sequences XP_007766588.1.51617 jgi|Conpu1|135940|estExt_fgenesh1_pm.C_4_t10005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]