SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|136269|estExt_fgenesh1_pm.C_4_t10369 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|136269|estExt_fgenesh1_pm.C_4_t10369
Domain Number 1 Region: 65-162,189-195
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.69e-19
Family Canonical RBD 0.0057
Further Details:      
 
Domain Number 2 Region: 262-312
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 0.0000000235
Family Surp module (SWAP domain) 0.0051
Further Details:      
 
Domain Number 3 Region: 353-489
Classification Level Classification E-value
Superfamily ENTH/VHS domain 0.000000693
Family RPR domain (SMART 00582 ) 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|136269|estExt_fgenesh1_pm.C_4_t10369
Sequence length 614
Sequence
MLDDPPSPPSNTASKPKGKRAMDAFLEEIKKEQAMREAKYSRGAHGRSVTALAAYESQSG
SKDRGDPETTNLFVANLPSHVTEQALGMFFARHGPVGSVKIMWPRGDAAVGPGGDMTASR
RNKSAGLSGFVSFMKRKDAETALRELDGFDWGGSILRVGWSKAVQVAARPLYAVPRAHSR
SRSRSPRRRDRSRSRSPSRERRRSHSPSRENRYRSSRRSRSRSRSPKRRRRSRSRSLSRS
PRRKDSVSPRRDDEDNDTGVTDGFIRAVAAEVRGQGNNFEKRLREWERDNNKYAFLTRRK
HRRHVFYRGLVERTDLTGSEFVDEGYNSAYSTDSAEESEQERTRKTTLGKLARKRFESML
RGLSGKRGELARCMAFCLDHAEASKEISDVIITSLLVDSTPVPRKVARLYLICDILHNSA
APVPSAWKFRQEFQSRLGIVFDHFAAIYHSFPGRITANTFKKQITSIIDIWEDWIVFPPE
FTAELRARLDGVSHAEYQPKAEEAQPTAAETEANFASRFKSKSFQPAAEAEGPALTIDNY
VGSGNAADVDGEPIDDVDGVPIDNVDGEPIDDDVDGIPTNDIDGEPMDDVDGEPLNDIDG
EPMDDDMDGAPIDI
Download sequence
Identical sequences XP_007766970.1.51617 jgi|Conpu1|136269|estExt_fgenesh1_pm.C_4_t10369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]