SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|137677|estExt_fgenesh1_pm.C_70226 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|137677|estExt_fgenesh1_pm.C_70226
Domain Number 1 Region: 8-151,185-236
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 2.83e-21
Family DJ-1/PfpI 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|137677|estExt_fgenesh1_pm.C_70226
Sequence length 238
Sequence
MSEQKELRVLCLPFPNFDNLDMNGPIEVLCSGGFPVPYNVTIAAADEHTRAGQGYRVQRD
ITHAEALATISSFAVLLVPGAYAGYIMPYLKEGETHFDGLLEVAEAFCKLGPMEDGTERV
MLSVCTGALKLAYRGLFDGLKVTTHFMSYDALQEILAGYKERNPGTAKGSTFVGPVEGKE
PRVRWADGGRNAHGVRVISSGGVSCGIDATLFFVSEKYGRDTALKIAEIMEYTWRENA
Download sequence
Identical sequences XP_007769435.1.51617 jgi|Conpu1|137677|estExt_fgenesh1_pm.C_70226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]