SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|137811|estExt_fgenesh1_pm.C_70378 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|137811|estExt_fgenesh1_pm.C_70378
Domain Number 1 Region: 15-174
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 5.18e-23
Family Isochorismatase-like hydrolases 0.00036
Further Details:      
 
Domain Number 2 Region: 18-99,172-269
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 3.53e-18
Family Isochorismatase-like hydrolases 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|137811|estExt_fgenesh1_pm.C_70378
Sequence length 270
Sequence
MGETRKTTLHTLETAILGKSALLIIDTQNDFVEGGSLAVQGGKSIVPTINKLLSLPGFAL
RIATKDFHPPDHISFARTHGKEEFADIEIHPPEDLAPDEHDRDTLGPLKQTLWPVHCVQG
TPGESLAPGLNVDALDAVVHKGTHKGVESYSAFIDPWGLCPTGLDGILKEGRVDKKSRAS
GDGSEVEKTQADEGEERVPVKDVFIVGLASDFCVKFTAMDAVREGYEYRTWVITDATKAI
KPDEIDKHWEEMKSKGIVLVTVDEVVQKLG
Download sequence
Identical sequences jgi|Conpu1|137811|estExt_fgenesh1_pm.C_70378 XP_007769671.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]