SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|138361|estExt_fgenesh1_pm.C_90244 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|138361|estExt_fgenesh1_pm.C_90244
Domain Number 1 Region: 15-108
Classification Level Classification E-value
Superfamily L30e-like 1.5e-29
Family L30e/L7ae ribosomal proteins 0.0000553
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|138361|estExt_fgenesh1_pm.C_90244
Sequence length 115
Sequence
MAPSKKSKATKSTESISSRLALVVKSGKYSLGYKSALKQMRNGKAKLVLIAGNCPPLRKS
ELEYYAMLSKTTVHHFAGTNVALGTAAGKLFRVGVMTVSDPGDSDLLTFAEGVAA
Download sequence
Identical sequences jgi|Conpu1|138361|estExt_fgenesh1_pm.C_90244 XP_007770890.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]