SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|138782|estExt_fgenesh1_pm.C_100261 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|138782|estExt_fgenesh1_pm.C_100261
Domain Number - Region: 175-219
Classification Level Classification E-value
Superfamily Ribosomal proteins L15p and L18e 0.085
Family Ribosomal proteins L15p and L18e 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|138782|estExt_fgenesh1_pm.C_100261
Sequence length 1416
Sequence
MIQICRAEDGESYQVNATLRDIERIGSLEIFLSQETGVDPEAILAYLTDGTRLRTDNVRE
LVGAQDQTIYVFNKYYLDIDLDHVLQSLRVAPPLQLPIEENIAATPPFRPATLASTYLAT
AQTHTDGTAHILSALHRQHAALRLAAATLERHVLALADVFDALAGPVREELARQARLLAG
VTGDLELVKRVRVHAEFMSVTTRKAIEDGGEVRTLGHYVSEQKMQQVAAGCRRTHEEFKK
QFEDAERAVGQLSEGTDEVRAAATHVDYVNDAETAARRAKEILERMAESAGTLDNPATAS
ESVLQELKHLDAALRKEVEAITEAKNAYTSQSISALRQISSLNVHLTELPNALTALQSKF
RGKNSFSHIQRLHGMVYAYGATVVEVVRRKEFENFFYQRAQSIMEVMAKLTSNERKRRQI
YRGEVHGQLPFDLRGMDGTVPGVEISTPARQDAPYNLEREDVEALLQMLQDLEDFAYQSG
DEGAFTSVRDTKDALEKLVHKMDNLGGNFDRIAERSLLSASRLGSSRRRLTEEDEQVFQE
LAIQLQDAQDALVRQEACMQEERDAHKADIRHLHNQLDDAENAVERERERADILERELHQ
ARAQIESETSARRVLERRHEEQLTDVDTQRKGLQEALADATEQARVAELLRQELASVRVQ
DEEVKVLEARNAARVEQLLEEQAAHLALLEETRAKGESLEAQIQAARDESAEVKRVLRET
DADRDRLLRAQASEHDRIMRDHRAEADGDRAVLEHQFSELRAQFADAQAAAKEARAQAEI
GGADAIGLREELQRVEHELREARHVERILREDIRAGRASQSAFEQSVEESSRQVAQFLEV
AIAFRNSHVKAQTIAQAAQQHPGAASKLQSQSMLESTTLPSSFPRQTNGIMGSVTVEEPE
PIDPSDPPAALETLRAFDHDHFLEVITKTGSIIRKWQKQCKEYRERAKGKISFRNFGKGD
LALFLPTRNSVSKPWAAFNVSFPHYFLQATGHLAEQLKTREWIVARITSITERVVDHKDP
SSNPYGLGDGVKYYMLEVEDWTQSSQLNKRRVTSRKTSGLSDLGFEPKPISSSPPTAGSR
DNTPIPPAPPQSEVENAFSVTVPPTSHLFPVRARSNSNSSAGPSSLSRLLAQAPADSPSS
DETPTPPPEAAPTPSPPSTSTVRPPPPSPTVPIVHQNPPSVPSPLRPGSRASRASVSSKF
SGGRLPPIGTASAAGAAKAAPTTALTEYTLPSSPPQTASPRSPRSAAVSVSIQSSSGSAN
ANGMGAGTGTGTDTGKTSGSGSGASTGDGDSKTRGPPSPRDSISEAMSNVLMSDAPGVRR
RTSSYHVPRATSPLAGLSSSPQKPSTAASTLASFANSWGMSFGRRKRNTADMSASLTGQH
GRDSSAHSSRSPMKGSNGADAGTEREPMAADLLRRV
Download sequence
Identical sequences XP_007771575.1.51617 jgi|Conpu1|138782|estExt_fgenesh1_pm.C_100261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]