SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|138810|estExt_fgenesh1_pm.C_100291 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|138810|estExt_fgenesh1_pm.C_100291
Domain Number 1 Region: 417-495
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000078
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|138810|estExt_fgenesh1_pm.C_100291
Sequence length 654
Sequence
MEENRYTPSTPDSEDDLQHPLGSSPYPSVVMGNDPFPSPPILYSGNTPQNIVGSGQQPPY
RYIHSQSPQQHSEWRPYGMGEHQHGQAPPLRQQSDLGYPESSQRTTFGVAHQQPSAVPPA
YQAYGGVSSPVNHLVLHQGHRSNAHTTPFSGASQSSIAMPDPTLPPAGPFDPVPIAHPHM
QQAYAQTPNQALQPSMALEPSYYSRGQHPHAHSQAAPGEESRTPSHLDLPSPHSSFPRMN
MYPPHQIYPEGQGYQPQQQQQQQQQQRHQPSIRSYDPVYSSMEQTPLPLPGSPESMARSS
PEHMYSYWPNSPASEPAWSGSMDDDESPSFERGDTPLSDTGRFGEYGYRYHDDEFDEDTV
TPTSPELESVSAAEARTSEFRLPSINELNLEDEGSGKGKEKAPTKEAQPKKPRRKSKYHD
CPVCGKAFPRPSGLATHMNSHTGSRRQFHLFLWPDKHSPDILWSSSRLLAFQCKVPGCDK
RFAVRSNAKRHLRTHGLSPDFDSGPREPRFVVGFEDPVVSHDVQPPERNPAKFKWIEEKQ
EGSGFPDFGRAPTRRPWAPLSSVPGPSRLPDRGNTAGRPPQQQRQYPPLTDQNTQSQTRG
GTGQRAVYPVPGIGSGSSRQTGRSDADEKEEVQQEGGDDSRHNVGGRRNMGYHF
Download sequence
Identical sequences XP_007771626.1.51617 jgi|Conpu1|138810|estExt_fgenesh1_pm.C_100291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]