SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|139116|estExt_fgenesh1_pm.C_120005 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|139116|estExt_fgenesh1_pm.C_120005
Domain Number 1 Region: 2-273
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.3e-114
Family Nitrogenase iron protein-like 0.00000000585
Further Details:      
 
Domain Number 2 Region: 306-560
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 2.37e-65
Family Class I glutamine amidotransferases (GAT) 0.000000582
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|139116|estExt_fgenesh1_pm.C_120005
Sequence length 614
Sequence
MTKYILVSGGVVSGIGKGVIASSTGLLLKTAGLKVTAIKIDPYMNIDAGTMRPTEHGEVY
VLDDGGEVDLDLGNYERYLDVTLSKDNNITTGKIYREVIEKERRGEYLGRTVQIVPHVTN
AIQDWIERVSKIPVDDTGEEPDVCIVELGGTVGDIESAPFIEAMRQFQFRVGHENFALIH
VSLVPDMHGEQKTKPTQTTVHALRGLGLLPDLIACRLLLPQPLADDTKAKISMFCHVSSE
QVFGVHDVSSVYHVPLLLQAQGILPYLRRRLNLASLNITPEMIERGTSLEARWKGMCKGQ
ERLFDTVKIAVVGKYTDLKDSYMSVIKSLEHSAFRVGRKMIIEWVDSSDLEPETQETSPV
KYHDAWRAVVGAGGILIPGGFGQRGTEGMLLAIKRAREAKVPFLGICLGFQMAVLEYARN
VLGVDGAQSTEFDTQTPEPFIIFMPEISRTHMGGTMRLGLRPTVFQPGTEGWSKARGMYG
GGEKIWERHRHRYEVNPERVGVLEEGGLCFTGRDEKGERMQVLEIRDHPYFVGLQAHPEF
CSRPLNPSPPFLGFVAAACGIGASGATVLEEVLGAARGYVPPHPAASMVGEQKLREATQE
HLVVNGNGDLSHTY
Download sequence
Identical sequences XP_007772461.1.51617 jgi|Conpu1|139116|estExt_fgenesh1_pm.C_120005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]