SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|139465|estExt_fgenesh1_pm.C_130145 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|139465|estExt_fgenesh1_pm.C_130145
Domain Number 1 Region: 647-758
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000968
Family Myosin rod fragments 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|139465|estExt_fgenesh1_pm.C_130145
Sequence length 1007
Sequence
MVCLLLLSTTGSSSTSLQSSAEPRESVESIASPISPAESMTAQFSNNQFHSSVRSILRDP
KTPGSGQNVRFFARQRSKTPSATSADNSAASDPSYFSVGSRARSRTPVMELFSPPNEGRS
QDAQRPSNPPQADNSNIFDMSQNDVPAIPHAPEDPVQLEEPANSDEHKQPFTSTPARALL
DGIKEPSVFSPPLPAQDEKQKFSSLSRSRAMSDSVFSRLARVASSHPLVEVDNDDTQTLA
NVRSGARTPPPLAPPGGPSSPPDPFRANANTYYTPGSDVPPTPPHALQRHTSNPSGSSSS
THSRSDSGSSSASNVHSQIISLRTQLTLHQSLVAQYEVDLAARDEIVHSLQSSLSSAQGK
LSDADKRRQQVRAWRKRVAELERVVRGLEGEVERSREESFERSIMDEASAGALRALQTRI
SELERERETSWRVSGASSSDASASASASTGRRSVLSTSDAHRDTREVEELLTVLAAKDEE
IARLRSQTLEQTAEVTDMISSSVYADARSRSRSRSIESLHPQNSSAEAELEHARAELDAA
RRELARLQDERESLHHDFSAVQHAHDVLTHEHSTLRAELEAQWAHTERMGAQIAGLRGER
DAALGEKDAFAAANEALAQKKSVLAAEVEALRAASGDSAELARRNGELEELRVVLEARIL
EIEEGWVTSQNERLHLESERDELTKQLEDAHSQIDDLTTALQDHSEKLSDLELEKLMLLN
NYAHIESTVDERNTEISTLQTRVRNTESEAESLRAQLSAVSREHKRVADEQSRQIAELAA
RESGVRAQLEALLRSAAEKDGQEGEELGRARKRVRELEKASADREFEVIQLQRANQKCKE
DAEGMNIALDSKQQELELLKRRMGVRGTAGTTPAPAKIASRRESFAPSSVASTPFIRPGS
AMSTASETPSVRAGALATSKRVNGALAAAAAAKGSTAAKRSTPPTRASQAQAQAATAAVQ
RSTGAGPRAKSPGVGVGTSAGAASRRVSFWTDILVRLRDRCRCQSQC
Download sequence
Identical sequences jgi|Conpu1|139465|estExt_fgenesh1_pm.C_130145 XP_007773126.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]