SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|139675|estExt_fgenesh1_pm.C_140143 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|139675|estExt_fgenesh1_pm.C_140143
Domain Number 1 Region: 3-84
Classification Level Classification E-value
Superfamily SH3-domain 6.56e-20
Family SH3-domain 0.00083
Further Details:      
 
Domain Number 2 Region: 903-1012
Classification Level Classification E-value
Superfamily PH domain-like 8.22e-20
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 
Domain Number 3 Region: 448-519
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.97e-16
Family SAM (sterile alpha motif) domain 0.012
Further Details:      
 
Domain Number 4 Region: 1145-1250
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000779
Family Calponin-homology domain, CH-domain 0.0059
Further Details:      
 
Weak hits

Sequence:  jgi|Conpu1|139675|estExt_fgenesh1_pm.C_140143
Domain Number - Region: 555-599
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00144
Family beta-sandwich domain of Sec23/24 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|139675|estExt_fgenesh1_pm.C_140143
Sequence length 1287
Sequence
MPEYVYAMHDFVPEHEDEIAFRAGEPIEIIEKDDQYSDGWWQGRNLAGKVGLFPKDYTAP
PPPPLPASVTSAQQAPVQPPPESTPAPPTTTNGLHTLREETEAGSMYHGSDAASRIGVAL
GDPVEEQRSQVGVMRATMTDVQKALEQLGQNRDRDTDGARSFSFASTRDGDTDPSDADDD
TDHEGNSTWHRDHRSKLAENARLIVEQQQAQAAAEARSKAPPIEVEMSDESEAEEDEPFD
HLSPIMQDRDHPHIPEEDEEEDERRSFSGLARLAGVSGSGESIAIAAPPADESQMPTVTA
MQTTFPSPPPVITTPPVQDPPQPQEPSLPTPTSPIEPVRNAIAAPVPVAAAAAPAAIPLP
LSPPEAAARVTPTPPAAAPVTPVANNNVLPSPSPSSLRTGTSPQQTSKHTSVASSTRNSE
SQPPATGTPATEVSTIVSADSGTRKARTPPSEWSVEDVVDWLKNKGFGQDICDKFIEQEI
TGDVLLELDINLLKAEVGIPALGKRMRIANAIAELRRPPSIVFPDDERSASGAQIISATP
SSLSQPSSRPYSHSHHSSVQHSLNSPIYPTHMAAALAQQQQQQQQQQQGQQQSMSQPNSA
TFLSTDNESAYGRASSFSMSRPGGLGLGLVGVPGQLGPSPSESALQVGSTDEDRGAMSDG
ETATTAAKQRRRLFGRSMESTSSTNSKTKEKERDKDKDKDKEKERERDSSKDDAPSISPA
PRPRKRQSLDDASISSRHRKKTSMDGNKGSERLSMFGHFSGSLGKGNRKPPPRVTSGLLE
DGSPEKSSRSISRLVGGGGKKSSGRPTTSDGTSSRSNLLHSFTHPNQQSKERKEKTGSKS
SEKDLLSVGGGGDRARPEVLRKRSGSPQSAGGPRSPGLAGNGNGNGASSVGGAANGGAGA
VKPGRSILEQIGAPDHQGWLRKKGDSYNVWKTRYLVIKGTHLYVLRSNAKAETKIKGYIN
IVGYRVIADENIDPGRYGFRIVHDTDKTHFFSSEEQLVIREWMKSIMKATIGRDYSRPVV
SSVNIPTIPLAVAQTMNPAPRPPSPSARAATQKALRRENPNQLSTRDARVLMGIGEGTPT
PVDNVPSGRSRERVNSIFSQSEEAEPLTPMTAVTRKTSTRSNAPPRPSREMRRMSTTPSE
QSSHTLSVNPGLIEWANAWLPQSLQVTDPSTQLYDGLALLRLAEAVVGKPSSPPVPDSAF
PKGPNDDKLDGLFRLFDFLLDNDVKMGSVSINDVRSGKRDKVVQLLKALKVWEEKRREVL
RSIGGGTVQAGPFMAAPVGMGVGAWRM
Download sequence
Identical sequences jgi|Conpu1|139675|estExt_fgenesh1_pm.C_140143 XP_007773509.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]