SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|139943|estExt_fgenesh1_pm.C_150153 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|139943|estExt_fgenesh1_pm.C_150153
Domain Number 1 Region: 79-247
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 1.45e-26
Family Class I glutamine amidotransferases (GAT) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|139943|estExt_fgenesh1_pm.C_150153
Sequence length 306
Sequence
MPSQSSRKFKFALLLCGAPVQAVIDKKLAEGSDETIGDYSQIIPRFLYISHPDYDPERSR
DEFFEVDAYDVRDPERRYPADDAQYDGLVLSGSASSAVNGKEEDWVNHLIAWTRDFADKK
STPIFGICFGHQILARAFGAQCLRYDDPGKGWELGTTTITLQGAGHKLFGQETGTLKIQQ
LHRDQVPGKPTSEGWEIWGYTDNTENQGMVKYRPGSSTYTTPTNIHILTVEGHPEFNKDI
LGPVIDSRMQNVKDPQTGELKSGPISEEEGLLGKQKMIVDAEGRKIGSLWWKMLGVEGPG
TQIFSA
Download sequence
Identical sequences jgi|Conpu1|139943|estExt_fgenesh1_pm.C_150153 XP_007774058.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]