SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|140410|estExt_fgenesh1_pm.C_190054 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|140410|estExt_fgenesh1_pm.C_190054
Domain Number - Region: 226-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000156
Family Classic zinc finger, C2H2 0.037
Further Details:      
 
Domain Number - Region: 260-309
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0414
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|140410|estExt_fgenesh1_pm.C_190054
Sequence length 326
Sequence
MASELSLTLSIPQLLQFRVCLGLTDGPPSLHLDTSQPSLSAPTADYSGVDVKIETHIVNG
QRTLRVFAAEKPGQQQSAKPSSLPPATSTFYNHDLYSSQPNVGEQSAAPSPQMSSQALPV
SYDFPIQDTFMNDMSSMSYSNPASFSAVLGSTDSTFFQDFMQSQAEHDQRIISIPSYDTH
EQLEQCTRAPPPSEATTPAVSRSATPTPTLEKQSTGAEQAVSRKRPRRFPCLDPSCPRRF
ASKYTLNLHMTTHRQSPRVRYPCEMGCAETFSRQHDRLRHEVSKHGRVCEWLCNRCRHVF
STQGTRDKHRCAEVNLSSPDSNSSGS
Download sequence
Identical sequences R7SHQ6
XP_007775210.1.51617 jgi|Conpu1|140410|estExt_fgenesh1_pm.C_190054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]