SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|140441|estExt_fgenesh1_pm.C_190089 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|140441|estExt_fgenesh1_pm.C_190089
Domain Number 1 Region: 25-81
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000253
Family Classic zinc finger, C2H2 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|140441|estExt_fgenesh1_pm.C_190089
Sequence length 819
Sequence
MDGPSTATVSAQSHTQTQQDKVAARPYKCPYPLCGRAFSRLEHQTRHIRTHTGEKPFACT
FPSCEKRFSRSDELTRHSRIHNNEHQSQHATGKRAKPKSEHPLHDDHLDQGNSVSLHSYS
RSTHESAADSSSVRIKKKARSRANSDDEGESYARPTALGSYESSYHPRRAQPHHLPQSNP
SAFSTLSSVAMDELYALERAEALRRAEYEARHAEVLRRAESDLRPPTDSHSSAYHMHGAR
MVKSATTSPVSTPFHFGQPLSGAGADAGYFGIGVSDERSTKNRRRLSGPAWQITPISSPN
STPAEAQTGRSGAAGQQYPASGTVSASAYSHASQHPASVHRQFPRQEDTPSPLSSDSDSL
PLPGSHANGASRTRYGGSHHDMSPPLVQAKPQPRDAAAYAYTPSASPFLGPLRTLNLHSG
YPSRAPSPILLPPSAHDEDDDDSMQTSPVDDDATRPHGYGYGYGYSQYATSGTRSPISGS
GAYSRSRTSSARKRPSADGFALPASAAHLPHVHSYPGQLSSAVGAGSSSGPASGAGNSSL
HALPTPQLSSGPSSSGSSPASFTHPLRGGHTYEPGAGSTTASPVGSRPASPPHHHERERE
QATGNGNGNGAPHHHHLAHSVRMAFGMTPIHSASSASTSHAHSHSHAHPHSPYPNQYTHT
ARTPSWPATAHPAQTQFSFKSPSRVGSGPGASAGAGAGVTAYGHRDGWGVASVPASRSGS
PPITLAPLKIKSESPGATMGGVGSNMGSGATSPTTATASSSTAMVVEKTKVEVEGEKGEE
VVETGQEKMAGGLKTEKTAVEKVELPTFKEFEASTLASR
Download sequence
Identical sequences R7SFN5
XP_007775274.1.51617 jgi|Conpu1|140441|estExt_fgenesh1_pm.C_190089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]