SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|140769|estExt_fgenesh1_pg.C_1_t10091 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|140769|estExt_fgenesh1_pg.C_1_t10091
Domain Number 1 Region: 76-280
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 3.44e-17
Family Class I glutamine amidotransferases (GAT) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|140769|estExt_fgenesh1_pg.C_1_t10091
Sequence length 328
Sequence
MATKTPAPTPAPRIAVINCDHTKDEFIKQFNIVPHLFRDLFRNFLQVKPSAAHPAPGGDT
SNGWQVWNDGAFYFKGFDATKYSATNPDFRWPDVEKEKIDCILVGGSSNSVNDLMKTDTN
LDWLKWLALLLADVAVHHPNVKLIGVCFGHQLLNHILYSAQIGTSPWEIGPYTVRLHDEH
KYLFPGGDHLQIEMFHSEMALTDAYYESVTKAREKVMDDKNSMFKHHVWGYTDTCKNEGT
VVFYDDSSDKQIHVLTLQGHPELTEPMAVRLLELFSGGGGQLEAVPPLEAQKAAQRMEFF
KAFAGELDWVRAAEAMWKVATGAKFDKV
Download sequence
Identical sequences XP_007762970.1.51617 jgi|Conpu1|140769|estExt_fgenesh1_pg.C_1_t10091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]