SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|142660|estExt_fgenesh1_pg.C_3_t20069 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|142660|estExt_fgenesh1_pg.C_3_t20069
Domain Number 1 Region: 1587-1652
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000253
Family PHD domain 0.016
Further Details:      
 
Domain Number 2 Region: 253-345
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0000732
Family beta-sandwich domain of Sec23/24 0.027
Further Details:      
 
Weak hits

Sequence:  jgi|Conpu1|142660|estExt_fgenesh1_pg.C_3_t20069
Domain Number - Region: 541-620
Classification Level Classification E-value
Superfamily GCM domain 0.000301
Family GCM domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|142660|estExt_fgenesh1_pg.C_3_t20069
Sequence length 2157
Sequence
MNIKGYTVCSPMLGVYSTVQGGRILWTKQDVRTGTVLTSVPQARYPVYTPAQNSLFILHE
CHSRRFTEGVYGMLEGCNTVTLLSTTGVPLCNLHRIIALRCKPAFCCTALSALLHHSCTT
LHHTALHFLHICTTLRCTAVCAEVVPFSAMWFIFPGLSFTGFQMSEQRAWISVNIKALEH
LLYSHFMKPTTQNQPSQAGINQSTSSPGASSGAGAPASNVASNPLVPILDAHRRVYAYTL
AYGHLEQSSSTTPPSPFNVPPPAPLPYSVPGAYPMHLLHPHYPLPLPPVPSAYQGFSPYQ
FPLAYPTHLTTQPTSIPSIYPFPPQGYTTNYAPTLPPTSTNTIHPLFNPLVKQVPTTSPS
ALKPEPKEAAASSAAKTSVGRAASAPPSSHHGHYSGKLSLRDTAWSRKPVLQKAQQNKNS
VKVVQNNSKPSDIKTSKLEHRTKTVPTQPALSITKAYRLAHKDDSDTDTSNSSDGMNSTG
YQTIVFESADDWDYKPNGAFEAEVSKKFHKQTRGLMVHWATSTYGVPSGPPQAKRWDKGQ
CSKRSCQGIITCENDSCNVVVRPQTRKSGIRVQISRPCHRCGASLVHEPCENVAEIWTWS
GGYHYRNGIHGHNHSCPRPLHASVKEEAQFIDICENHPAAGPAKLIAGIATLSGDRRSVA
DISPAYVNIDRVTKDRQKLKASVPRGGDTFIFDFSHFDRSHPNFVTSTQVGNVTVLTMQS
KFMKTLLLKDHITDEPVNGFVTDATHKYFADHNALLLITATYSLELTRWVPVQFAYLNGA
TAAHYRQHFLALFKSIALQAIERKIPVTDDLFAGVVDFSDAERIGFEEAFVDFWNLHRQI
DDCTEDQLRDAAKRCLKGCHQHFIAGTTRLKRTGIIHSDRNSKSYFDMCIREMMNTHDHH
QFQTMVSQLRERFPKAKSWLDWWLRPEHAALIFESQRKMKPPIWEAIPFSTNASEAMHAQ
IYRAISNNFALMEGLNGLYALHQYFFRLYVAALAGTPIKYEPGIPWKQRTEEIGRSKSGR
RPTVHLRNNGPPFKKSELLKHESKQTDRENIGCPWTKLSCWLDTALELLFWTAMRDFDDY
RQHFNHCLTTADFYKLFSIVDLRYMVITDDPSALGGDTSKLLGEQRDMFRAFLKTVGIIS
SLDAEGSVFAWLSRLVTDSRFFTGDSDDFLAHSYFQTLKICIRTCNGIPLKKTQHKPTHP
HMQISSQPQTHFGLSLFSQDHTTYGGSVQRWFQAITRTYTPHDQIGSGCWREASGAKYCH
GQGEVTTVILSLPVMLIIDVFDDPTHNRPLSWDVPKKLQMPVPKGEDTSTHGLFYELVGL
ALYSPTDQHFIARYSASPLGGLKESIYTYDGMHYGGQRQRVEPVRGQSILAGANPILPPG
YSPNALVYRLHGGLMAQQEFYAQRLKDIQQVYSIAASPDSFGAHPYLVVCKEGFKQLDSS
KRLWTQKTSLVDYEEEAQQDLALAPALLESDNSGAPQTLASNTNIVQTQVVADALAPPEP
DPEFPLYLSSSFVSDVNLTIPISELPVATGQPQAVPSTSECPTAPDWVAARPSDNEPAAE
HLAEPKDSDTQMNLDHDKDKGSTSSAMSDFLIKCQCGLQGDGYAVDHDDDFVQCDECGNY
SHVACQRDGRASGASSCKKFVCDDCDFWVLKKRTERPAPSRKSNRHLKRRPKDFKDLPTT
PLAKRLKPGIGALARHGKYYYPVRLLRRVYSGDGTVAWKVKWWRRCLFSTRCSPPQYELP
IPEQDVVDALWHDWKTRRMIRLGQFVHAAEEEDCKNIVSSFEDYPCPPDIASILLPHVER
LCQLWMSPDSVNPDDFPVMEYVRSYRKPKNNFGQYNIPHTGDLTTLEQAQIANWFYCHVT
QSSKESIHVLSWLECAPLAHAYTIVVAHKKRQQFHSSPSFNTSLPEKEQVRLIFRMAWTD
LSLYSSQLDPTDVDRECLGQLEDRMFQKTYDAGLAGNDQWGLDAGSHQHGWNPYAGVRNV
LEDEDEEGSETECQDATEKDSQERNLRPTGSNHRNAGEATEKHSHERNLGPTGSIHQNAG
VWAGAPNVLSQYVRLSVSRTSEAISLIRWCTRFHNTGAPGYRLILAIWVPNMQLPSTGAH
RKVLVHRNLFREMCELRSTLEKIHGPALPVEGQRTQFCRGEAFHRARNSYHISSTLE
Download sequence
Identical sequences XP_007766057.1.51617 jgi|Conpu1|142660|estExt_fgenesh1_pg.C_3_t20069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]