SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|143342|estExt_fgenesh1_pg.C_4_t20167 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|143342|estExt_fgenesh1_pg.C_4_t20167
Domain Number 1 Region: 5-228
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 8.99e-58
Family DJ-1/PfpI 0.0000422
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|143342|estExt_fgenesh1_pg.C_4_t20167
Sequence length 230
Sequence
MTTTKRVLFVLSSATETLTGAPAGWYLPEAAHPYYVLAADPGISVDFAAPKGPNPPVDPA
SVQGFPDDIPFLSDPAPKRLLETARVLATVSAADYDAVFYVGGHGPMMDLAADEANAKLL
MDFWNANKIVSAVCHGPGAMVLAKLPNGDSILKGKNVTGLSNAEEEAIGKTKDVPFLLED
KLRELGSKYTLATKPFENYVVVDNGGKLITGQNPASAKEVGQKILEALKA
Download sequence
Identical sequences jgi|Conpu1|143342|estExt_fgenesh1_pg.C_4_t20167 XP_007767207.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]