SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|143427|estExt_fgenesh1_pg.C_5_t10038 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|143427|estExt_fgenesh1_pg.C_5_t10038
Domain Number - Region: 201-285
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0288
Family Myosin rod fragments 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|143427|estExt_fgenesh1_pg.C_5_t10038
Sequence length 785
Sequence
MTYVPYHAYEGPTAPPSDLGRPGDTFLDTESSELYARQIGKWMEWRGPVPSKRTMASQLN
ETTWSEFRSLLIAHPDFPHADRLLWCDGHEMGWFGRPAISGKRKDMFEEMEFGLDDVGNG
RAVVKRLLETRAKGGKRVHEDAPPTVKSHKKSRANTSKAQRADDIIHSATSVSTTRTLDV
APVDDMMKVFGKAMEHALGAQVQTQEGELKTAQVKIQALEQRISELQLKHVMELNRLQNQ
LADENEQRLLAETGLAREVKGHKKVQKRYDKLTANVQRMHSARSERPSHFTHLAVRAQHS
LISIMVFHPYDTRREQYEMVAGGAAFVISGAVDLASHKNDSGPASQRVVAMSFESLPEVL
TLFLSFLVTITTEAIGYVHGVTLRSALTEENRLHFNNKARLFTATRKRRITGPNGLYCNI
LTAALFILSTVSATCIFTKQSDDNALLVSLVPMITLGICLVVQALIAAYGLHTTRIITWD
STALGTTLALSRLRIIHHTKGRCMCNVTHLGSGPCPLKPSPSQPSAWQARRDVRVTMISM
WILTGVCAGFGGIFMYNSSPYLGDIAPTGWTLIARPGSPSASVFLHNTEGQVWFSLFGLL
SIIQGSLALALHQAGNVASALRDEQVWRETTSAKGSPLETSIIRAILSPPYLLLLASKPI
LHWMMSLANTVVIGLENPGELAWHYVYLNAYQYWNLSIAAAVLSAVFTVLVLLRPRGPQP
AAYGHFQTLANLIDEWPDQGDEQSRLFWGHKGEYKEELDDDVKTVFHAGTSEKPLETVRI
GETYA
Download sequence
Identical sequences XP_007767595.1.51617 jgi|Conpu1|143427|estExt_fgenesh1_pg.C_5_t10038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]