SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|143481|estExt_fgenesh1_pg.C_5_t10111 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|143481|estExt_fgenesh1_pg.C_5_t10111
Domain Number 1 Region: 166-239
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 0.0000000000258
Family Barwin 0.073
Further Details:      
 
Domain Number 2 Region: 383-484,613-748
Classification Level Classification E-value
Superfamily RNI-like 0.0000000883
Family 28-residue LRR 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|143481|estExt_fgenesh1_pg.C_5_t10111
Sequence length 884
Sequence
MWVNVLCHASHITSALFYLDAATLVRVLDAMCWQLLRCVNTHLIPLVVLRFVMISFRGLD
SPTIGTEMCGDRHDSLSALAYPDHVRIWPLGLCMDFEVYKRAPRWNHSQNTFDTSSPLTK
PYYINLCHVRFQGSRICRPRRRYQRCFHHRHPDRYWILPLLVRVAAACGIVSQDTDLVTS
VATSVFDKSLCNKEINASYNGKNVTVKVTDSCNPCSAADLDFSPSAFENIAPLSDGKIKA
MHPALDIVELLRHIFGYLNEDFDITSGCVNGRTLSALARTCQTFKEPALDALWENLSSLD
PLIKCLPEGSQKLVELPRLYQWVLAEAPRFRLAFSQPLTGADWLIIRNYANRVRGFYMTS
LDLDYLDVLLELSLGPSEMLPLFPNTRHLEWTVTHTHFRPYMRMFLPSTLESLRFAISSN
SGRGDASILAAIGSLCPSLKKVDVDFSKNVEGGLEAFSRSVCNWKHLVSLRCMDITDAAL
AHVAGLSALRDLSVTLPPVTSFRAIRSQIEGNAFENLRALEMRAESLDVFVALASEMTLS
LVDTKLMIVDNGCSESAKDAFMVLSNSSRPLYSLKIHGWGDDTFIPMPLNSSQHIRGRTV
TISTFRPLFKFGELRILDVDFKCSTVFTNSDIIDLARSFPLLEKLSLNVEHGWEVPSAIT
YSGIFSVASICPHLQDLGVEFDATGTDQAELLLDTFPEDEQTQVSPNANIKFLGVANSRI
EDVIATVKLLLRFFPNIEHIHQWYPPFTVGSGFPDWLSPDYSEFMRRWGKAGAVITRLRA
RNPASADGDVEIEDLMPTDTEVNVYDDDDEESVDFEGDDDGAELMDDFEEGVSDEDAFGE
VIYDDDEVKVPEDEEEQLDDEGVDEEADIEDEPESDDPGDSEED
Download sequence
Identical sequences jgi|Conpu1|143481|estExt_fgenesh1_pg.C_5_t10111 XP_007767678.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]