SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|143507|estExt_fgenesh1_pg.C_5_t10167 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|143507|estExt_fgenesh1_pg.C_5_t10167
Domain Number 1 Region: 19-137
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 1.95e-23
Family Barwin 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|143507|estExt_fgenesh1_pg.C_5_t10167
Sequence length 137
Sequence
MFFSKALVFATLAVAGASAAVIEKRQSYLTGTQTGEGTSYAVGTGACGVHNVPSDLIVAV
SQQLFDTYPGYKGGNPNNNPVCGKKIKANYQGKSVTVTVEDRCTGCALTDLDFSTGAFEQ
LAPLSVGRLHGMTWTWV
Download sequence
Identical sequences jgi|Conpu1|143507|estExt_fgenesh1_pg.C_5_t10167 XP_007767739.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]