SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|143709|estExt_fgenesh1_pg.C_5_t10459 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|143709|estExt_fgenesh1_pg.C_5_t10459
Domain Number - Region: 1097-1125
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00199
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number - Region: 1130-1155
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0532
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|143709|estExt_fgenesh1_pg.C_5_t10459
Sequence length 1397
Sequence
MENGQPNHGAPTSNSAVSVNTNVPPFLDERRYNYAIAHIQRARQQLDRYESTINNSHQRY
LEETIDQGRRAQQMLQIMYATQAHGQAPGQAQVQAQIQAQAQAQVRAQAQAQSGSNAQSI
QAPPRVASVHPGWFPPPNSAAVAVDPRGNQVPLTARSDSPRMMNPFHASAPMQDGRAFSQ
VGAQQRVPQFAHHQGLTQQHVNPTSHPPHPPGFPNPDQIPQGHSMARIPMNQASAMANYW
ETLGRITQAQQSQQQQKQQFNPQVQPHNNQTPYHLATTTSLDNALGNTFGDRPIGAAQAN
GAAPANRSSSTHVRQTNDTDGSGQNVRMQETQLEYSRSESRHVQSSSPPIVSLPTAELQR
NTAGLSSSIPGAAQSKDALLPKPSESSFAIPVQKSIAPSNVSGTEFPHRETAVRQNPAPL
TLQPSQPGGQSQDNRAPPEPTTTSLNTFANKPVRFEAPSESPIATQTGQHPRLPHHAIRS
HALRPLSEMNSSQHTTGSIHVPGPSQRIPNLALVHNQSPINAARSLDPSLYRPFSFSNHP
LPPNAGPAPPTVDSEAPRTSPRQRSPEAGPSSPAPVIAALSPPETPLKIRASPNPRTPSQ
ADMRRLAKDIQRSLRRPGMQAPGQRLPSVNALGPKPIIKSSQQSQEPLLDFKPRDASSVD
SQTTEVDMAIHNSAPVALIAAQDESLGAKELQPQLHGADAAVETSRGFMVGQIRNSLPDS
SYAITQPTPNQVPLSPDGGQAKGNPVSNDDGEHETAFVGPLPQPPEQIVLEGYQEYVNPS
HLPFPEPAPSQPPTVHPTVDVDIPSQRYGHLLIDDDTIANSSNYPSTLISPSFGEAPFDI
AMEYTTSHNDQELELGPSTRIEEVIASPVQSTSGRVHEVSVVHEAISPSQFGPGHSNQSP
VQERVRPPIASLAGPSQATHVHEVNSTELLSFGHTQETPIREKSGTQAAIKTPLFLHSPT
PSPEPPCLPAELTSSALDVIDLTADSLADGDPVIPSQADPIAATATKEYTVISSKSSSAA
AESTGGLVRTSTKRKRTSDTRKSFYILVPTPNWLRRKRRKAGGGRPARLGGEHQKSHNFT
PEEQQILEASGQMLRERPCLWKDCQAVMNSGDNLFLHIIRHHVPTEGVVQCRWQDCNQVL
ASTGTVVEHHLVSHVLRVMPCPDIHCFEDFSDPIDLLQHNKRHQNDDRYLFKVTKPYHPI
VAAEPEGIPTIMPSYQSVPRRISQHPMSRQDHDRIGQMVLRNIFAPVGLKLRKQNAPMRT
RGSRLLYEQEGSSHSRPDEYDFLASLSSGPAKLMLADIDNHEVTKMCEADLVLWRGDDLC
WNGQEEFGVAMENEDGTNLEGPDGLIKGNTTGKDADPDVIEEERDQTFARSRGSEMSDGT
DGRNVGEEEDVALMLEP
Download sequence
Identical sequences XP_007767992.1.51617 jgi|Conpu1|143709|estExt_fgenesh1_pg.C_5_t10459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]