SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|144023|estExt_fgenesh1_pg.C_6_t10176 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|144023|estExt_fgenesh1_pg.C_6_t10176
Domain Number 1 Region: 52-67,112-296
Classification Level Classification E-value
Superfamily RL5-like 9.65e-28
Family Ribosomal protein L5 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|144023|estExt_fgenesh1_pg.C_6_t10176
Sequence length 298
Sequence
MSAATAAKAPRALSSMRGWRSPPRIRQPLRKDEERLPIPHVDLVVGQTHHSRVGDHYHNT
LADDLLYMTYTHELGERKPPRQIRLRFDPDDPYVVHRKNLPVGGDHRQLAQLPPAMTPDN
VVRLERIVLHSMQKEAVNNRSSLLGVIEAFRAISGKNDAGGGRAKGSGVQIVHAKKNVGG
WARAGIPTGVVVDIEGAPMYDFVSTLVEFVLPRLREFNGITLPAPSASTQSPSSIAGVVS
FGLPPDAMALFPQIEVNMDMYPKMYGMHVQFITNAVGLGAQKRAQALLSGFQIPFARK
Download sequence
Identical sequences jgi|Conpu1|144023|estExt_fgenesh1_pg.C_6_t10176 XP_007768527.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]