SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|144163|estExt_fgenesh1_pg.C_6_t10358 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|144163|estExt_fgenesh1_pg.C_6_t10358
Domain Number 1 Region: 378-444
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000144
Family RING finger domain, C3HC4 0.027
Further Details:      
 
Domain Number 2 Region: 535-574
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000212
Family RING finger domain, C3HC4 0.0077
Further Details:      
 
Weak hits

Sequence:  jgi|Conpu1|144163|estExt_fgenesh1_pg.C_6_t10358
Domain Number - Region: 458-522
Classification Level Classification E-value
Superfamily RING/U-box 0.00618
Family IBR domain 0.062
Further Details:      
 
Domain Number - Region: 247-294
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.016
Family Myosin rod fragments 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|144163|estExt_fgenesh1_pg.C_6_t10358
Sequence length 601
Sequence
MVTLPSPSAAAGDAANAPQVSGPVVERIVSHPGLSQFQGKSASACGLAALNFARHVFERR
RNGESTERILQEIVRKPSMEEIISITSGWTDDGHLEVDQICQLPLFKSTLKLVHTQFGQP
TKGDFRTLLRNLGRTTSSCAVAIVTRPPEIIACLKITNSGGNTFVIFDSHPRPDHPDGAA
LILVNSVEEAATRLSAILPYDDALMCDDRLQWQAQLLGQFSSHTFIAREFDSSSTAMTYL
VADASLTILSLQAKVAALESQNSFLTSENKRLETEAEQMEDTRTALEAQLRELAKPSSRG
APAYPRSSAKNAEAGPSRPRFPDNVGEGRAEDRHDVSMLEPEAAHDPTAQLVAEMQQRFD
QEDRHIRQQRESLAASQQKPFECNICFEEQSEDFAVRLQPCGHPFCRSCAREFILSNIND
HRFPVLCPVCSAEKAEKPSTIDSWLVEQIGVNQEQYAIWTEMELARFSILLHCRSCKRSV
FIDRQDHDDTKILACPLPRCNHIWCKACQASIQLDGPPHSCDGSSELDHLMKQRGWKYCP
NCKTPCEKVSGCHHMTCISAGCNTHFCYRCGDVIVRSAMPRDVQRATSDHYRRCQLFDIP
T
Download sequence
Identical sequences jgi|Conpu1|144163|estExt_fgenesh1_pg.C_6_t10358 XP_007768716.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]