SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|144305|estExt_fgenesh1_pg.C_6_t20036 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|144305|estExt_fgenesh1_pg.C_6_t20036
Domain Number - Region: 89-113
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00108
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number - Region: 135-157
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0372
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|144305|estExt_fgenesh1_pg.C_6_t20036
Sequence length 263
Sequence
MTFIPEIATLPATPRPFAPPRFARKAYARPTDHHGNSDDTTPPSSSASQVGEEPTKPASP
LLVPSTLDRADSSPAPAPSAPVVPTKRKYTYRCPYHDCGETFTRKTDRNRHMLNACISES
AEAQGARREHPSPTWHCPVCGKVLSRRDATERHINKGTCAKGRCGMCGDRMTERAIKGHL
DDMGDGNMKCFSAKLATKAARKSKKRKLEGKEDEEEELEVEVALGEDDLDDELEGDDVKE
EDRKVDNEQLQPLKSEDATMEGC
Download sequence
Identical sequences jgi|Conpu1|144305|estExt_fgenesh1_pg.C_6_t20036 XP_007768904.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]