SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|144499|estExt_fgenesh1_pg.C_7_t10211 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|144499|estExt_fgenesh1_pg.C_7_t10211
Domain Number 1 Region: 97-214,253-317
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 0.0000000000000547
Family Class I glutamine amidotransferases (GAT) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|144499|estExt_fgenesh1_pg.C_7_t10211
Sequence length 367
Sequence
MPSPQPLRVAVFSCGPVEGRMKTELGFTAGAEGTREIFHKFLIENPRVANPLDPNQKIFN
PELAVIANGLQTIVYDVLGDGEPVPTDAPIFDENDPRLPSEDALDTIDAIFVSGSGTSVR
YVEDPIKRGQWEGKIRRVQRYLRFVIDNHPRIKVVGICFGHQILSFASGHAVDRNPKGWE
VGPKNVTMTDLGKSVFQKGVLVIQQLHQDHVLLNVEVGGIGDSGSGGYGATPRSGSTRSS
DEVVIDRDITPLDGLSRWGQSDLTWNQGMIKIPEDVVDDLDDPKLHLEALEKVHIFTSQG
HPELDRDMIRVLIEDEMEPYVSGGIPADRALAALARNEDKNIEINVDDLAIVCWQMLKGA
WDAKNAA
Download sequence
Identical sequences jgi|Conpu1|144499|estExt_fgenesh1_pg.C_7_t10211 XP_007769357.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]