SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|144651|estExt_fgenesh1_pg.C_7_t10405 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|144651|estExt_fgenesh1_pg.C_7_t10405
Domain Number - Region: 551-620
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0199
Family Myosin rod fragments 0.025
Further Details:      
 
Domain Number - Region: 313-398
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0262
Family Myosin rod fragments 0.014
Further Details:      
 
Domain Number - Region: 47-257
Classification Level Classification E-value
Superfamily Tropomyosin 0.0275
Family Tropomyosin 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|144651|estExt_fgenesh1_pg.C_7_t10405
Sequence length 921
Sequence
MSPTLATAGSNACSPLSTAALALIARPNHYFIHDVCPTAPTNDAPIEVELEALTQDLVQH
EEDSDDVISLESGFSELLTTEDADVAELRKRCNELEQVNARLCQEKDELVVKRDELEGRV
ETLEDQLSQKPVASCDCREHCDALSAQNADLVQKQELLVAGMATLRGEVAQATERAELGE
SNLAGFRGRLRELANDVQHLSENNEALVAAKEKLGSQLALERDAFGQRCGQLQAENDRLV
VAEKTLISANEQLSAQLNATSQALEQSRERSSALQSHNNDIVRERDALTSRNAVLATNLS
ELAAELKKTKNMLGDYQGRYAALKEHSKGLSAENRRVAHELDVADKRIAKLSTKMKTNDD
NHAKLVDKWRDAYNGLASDKDSLAGEVAQLQKDLADRDRKLGDALVWSSDMLTEIGGLKE
QSTKLERAVRMSRQSLEQGTREDRLRAGLHGNVTLSPTRVYLFARSPMSAILKLVYPRQP
SPTAPMASVRDEVEEMLHQGASFESDEDVHSESDLISLSSGFSNILYAEARKLEGLRERC
ALLEKTNAILGREKAALTTEREGLQGKVEALEVDVREWSQAIRDSGEHCDALEARNADFT
RKQEPLETGAHTLHHELGQLVDDASARRSDLGLRGRLGRLKGECLRLGQDNGTLLAEKKR
LENQLALERDAFGQRCDTLHAENVKVVETKKALASANVSVTQLTAQLNEKSEVLERTRRQ
CTTLRSHNTALNYERDSLASQVDTLNVDVSKLADSLEKNEAAYQSSKEHCEALADRNRVL
TQEKDTVTSERDAYNQRINGLVAEMETKAKDHAEHIEIWRRSHNTLDYNRTSLSGQVTQL
SNDLANRNRAYGEAKERCADLEARVERLETRKKSLKAERDSLRNAIHQSQQSLPSGQFGG
NTYHWPHPTVATPFWAQGAYR
Download sequence
Identical sequences XP_007769546.1.51617 jgi|Conpu1|144651|estExt_fgenesh1_pg.C_7_t10405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]