SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|145080|estExt_fgenesh1_pg.C_80453 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|145080|estExt_fgenesh1_pg.C_80453
Domain Number - Region: 23-78
Classification Level Classification E-value
Superfamily Osmotin, thaumatin-like protein 0.0115
Family Osmotin, thaumatin-like protein 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|145080|estExt_fgenesh1_pg.C_80453
Sequence length 546
Sequence
MAIAALFTLAIAAVVSVAQAQSLTVVNSCTESVFLYTQNSDGTIDNDVTVAASGTANMGI
SSDWDGAINVGTGCNSDGWLLTVELVSDVKGTRSMKFLESDGAVESTKKAKKISCPNTSS
QGVELNEKSHKLLKKPSFWSKISKTFKGAHTQHEPRLRPERCEAPRRPSRRCKSMADLGN
WRGDGSVGVHPASHLETLPRSGSISDPLAPFSRYNPSTQLQTDRWCQVSCRLDLEDLPDF
SFDDVPTSSIMSVEAMESDDALQSNDNLCASSVTTSSNTTAHSISTVAPSDFYSAGHKNV
SLCELAVSPTFESGVAATSETNLHISGPSESDHRMSRYAWVSAALQSIGPAKKTASCEDL
SSTLHPAPESSQVPCPSRPRRSASISDLRSPYSVVSSPPQRDVANAFSPLSTGSMTPPSL
SHILDLDRNLGNVWGLTQEDVTLDKSAAVGSGALPKPAEALRPPPAPALVSSSCHMPYTP
GCRLSTISEASETVTVASEMVASEYHHREEILPVRGRYVPLGQPKPPQNATPLRSFSVPS
HTMYMF
Download sequence
Identical sequences XP_007770360.1.51617 jgi|Conpu1|145080|estExt_fgenesh1_pg.C_80453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]