SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|145812|estExt_fgenesh1_pg.C_100414 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|145812|estExt_fgenesh1_pg.C_100414
Domain Number - Region: 340-572
Classification Level Classification E-value
Superfamily Tropomyosin 0.00412
Family Tropomyosin 0.0033
Further Details:      
 
Domain Number - Region: 977-1097
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00471
Family Myosin rod fragments 0.0067
Further Details:      
 
Domain Number - Region: 718-823
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0915
Family Myosin rod fragments 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|145812|estExt_fgenesh1_pg.C_100414
Sequence length 1458
Sequence
MASLLYALDPNAHAYPDPHAPSPPDPSTSATLANATHFPPPEPTPPPIPYLDVFTPDGYF
RLPTAPPAKDADRPLPSSTASTPRADSVASSNAATPTHSPGPDPDPDASQSMHADTDPDP
DPQKHADTPPTLSRALALGTSALLTLIEAEAEAAAAIVRGDLADARAAHDADVKAYTHAW
EEVVKDKIKVESRIHLLEYQLKHALRDPDAERQRQWEKHVENAEAEMERERKAQWRAIAR
VVSESGGRLRKRQGSGEIVLEVGERWVALLRGEAVGEGEDQPMQLDEHDLDKDGHVPLSA
FHTQLAEHLAALSDERDALQTELDALRGEDSAAREGREALDALRAKYSELEAAHADLTER
HTALETSHTALQREHTLLADEHRSMGTQLASLASSLSSTQSSLATTQSSLSETQTTLSST
QSTLTSTQTQLDTRDAELAVSQSIAEDAQKALEEALAAKDAASANLEPLESSLADLCAKH
AELQTAYAELQAQGGADAEKEKEIEEAKAKEKDMQRTVDHTKFALLEMIARLARARENED
DARVALAAAQDAKRALQTALERTARAAEEGLGAAARREAELAGERDAALERAEGLVGERD
AVEARVREVEAEVQALTRTLGEATKRAEDLALERDGARARVRELEAAREDDKGKNKEEME
ALILERDAAVARVAELERDLSVARGEMDEVKDALGALREAARKEMDEVKDALREATAKVE
GALAAERAQARVVREAHEALQTQHSTLERELDAEKADRKAELGNTLDAAREVLEAKETLI
TSLKSSHTETLAALTARLDASEKALVDTTDRAQALERDLAGARGALAAKDAQIVASADQR
LAALADATARLAESEQSLAGARARAEGLERDLSAARTEMEAMEARIKANEDERAAELGDL
AARLDVVRRELGEERKQVGELEHALSDAKRETREVEESLGASRAEAREVRDRAEREVREM
REARAAADERGERVRVLEGECGALKERVEKLEAEVARATARVLDMQREVEDARASAVQAQ
VQAQAQADAPPVESTAAQTQKDEAESAQLHNLVETLRTQLSALESQLADTKAQNAAFAAE
RAATIGELGQLRAQAKALTVERAKVRAQALSGASGVNGHGHANASGNGSVGSSLTSVGSA
GSSGLSVERKAAVARRSNGAGQGKDKEKEHRKVNGTQVNGIRSNAKPKPSTAHRPRSPSI
MLLDSMPPSASRPSSPPPPRRARAGVGRTKPPSSRKRPHPPDTSDAHDSEADADGDTDDE
VRSVPEMEGQSASRSRDRRRDRAPAKKRARRRTPSSPSELSRSRTRSDRMNPSDDDSDPD
QEPDQERDENENEDVDASSSERSPSPPRGRNGAKWFSPSPPPPDAINDASASARTRSRRT
RQGVAATAVAAGSGSGSGVVAGAGTSAGAGAGAGNTEGRKGMPKPLTAGIVPVGRTGGST
ASRRDSMKGADARGGGRR
Download sequence
Identical sequences jgi|Conpu1|145812|estExt_fgenesh1_pg.C_100414 XP_007771668.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]