SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|146018|estExt_fgenesh1_pg.C_110313 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|146018|estExt_fgenesh1_pg.C_110313
Domain Number - Region: 542-567
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00239
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number - Region: 464-489
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00251
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|146018|estExt_fgenesh1_pg.C_110313
Sequence length 662
Sequence
MRSLIVSKNKGEHEDGNESIVDGMRPEADIEAGAVLEVGKQRGQEEVLRGPSGRGAQHVD
SIASGKVDIWPGLHRSPPVIPVHLTPVYPTRHVSMAATSQPIAFSVADNSSDIYMTSGSY
RSRNGSISASYYMGSPTSWRAGSFGSRFYPGCSPGQLLGPLDPSEFKCAKMSSSLESDSG
LMSVLGAPEREDEFCKNYSCCGLQIDDLHGLLQHVEEIHGSATDVFGNPQPIVSVCPTPI
RTQSSYFPDTPLQTSSHGSFDPDDMDLDDEDQSSTPSSSNGPTPPDTPISTPLLSHPINS
FNHYVSSKLSDAHIPVSPFAFPSSRSTPPIGSITPEAFNGYAGYTDYSSSMPGTVPSPRA
SEEPSQPASPVSDPGSPYGCLPPSLVFSATTTPANTPAHSRVPSPSSATRASVPATVGVQ
ASTSSDSAAGPSVVAKASGSSSSAQSSARASTTLSRPSSSLLLSKPFRCPKLNCNKSYKQ
ANGLKYHLTHGSCNFAPPKDLEQVQALLASKRSQREAAGEQNAQITEGEMREVEREAERR
LRPFACGISDCQRRYKNMNGLRYHYQHSGDHGSIGLSLLSSGQHECLQHAHSKSAASSRH
STPLASGASTPVGGASTPTYAQQYQQQMLFQSAQQQQYMRTMQVQMQAAYPSPAPSPDGS
SA
Download sequence
Identical sequences jgi|Conpu1|146018|estExt_fgenesh1_pg.C_110313 XP_007772219.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]