SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|146331|estExt_fgenesh1_pg.C_120277 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|146331|estExt_fgenesh1_pg.C_120277
Domain Number 1 Region: 24-163
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 5.71e-16
Family N-acetyl transferase, NAT 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|146331|estExt_fgenesh1_pg.C_120277
Sequence length 218
Sequence
MYDINANFVFPLCDLENDNVKTHTLCPPEDIDDMLHQRIGPDPSLALYAVLDKTTSSAAT
VGDGNASGYALAGVIGWIGASTAHLKAEIGFLIIFPAFQRKRIAVQSVGLLLRQALDLPS
SPTNGWGLRRVIWQAYVQNEASLRLAERMGFVQEGVMRWDRVHPVIDNVEDTTLQPRKGD
PREENAGRHAVVLGLCWDDWEKERERILGLAQVEKPMN
Download sequence
Identical sequences jgi|Conpu1|146331|estExt_fgenesh1_pg.C_120277 XP_007772741.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]