SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|146904|estExt_fgenesh1_pg.C_150001 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|146904|estExt_fgenesh1_pg.C_150001
Domain Number 1 Region: 212-299
Classification Level Classification E-value
Superfamily F-box domain 0.0000436
Family F-box domain 0.0057
Further Details:      
 
Weak hits

Sequence:  jgi|Conpu1|146904|estExt_fgenesh1_pg.C_150001
Domain Number - Region: 405-473,559-722
Classification Level Classification E-value
Superfamily RNI-like 0.000369
Family 28-residue LRR 0.054
Further Details:      
 
Domain Number - Region: 154-219
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0575
Family Myosin rod fragments 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|146904|estExt_fgenesh1_pg.C_150001
Sequence length 877
Sequence
MARSVIAEGDTQPTHLMKRAEQESEGRVTVNVAQPLDCTREVDVSSVTCLLRAKLGKIDY
KSWDNRETCNGAVVFGEEAATGWVRWYWMVDALETLAKLQHGMSSSPKERVRTMPAANMP
TPTRWGRRDALAAEAKRRRGHQREEQQRGGTCREREDESYVEIDHEVRSINAQVDSLQRR
EDELARILQDMQRLHAAVQAEKRSLLQQRVQLESQKQPINWLPSELLSRIFYHVLWQDPA
SDNDSCFSVQRNTFYPDTIVLSQVCSLWRQIALSTSRLWSYIPYRTRRWCPNVLGMSLER
ARSSPIDLIYAVRSRDVCAKANAQEEVRTGKELLKTVIRPYSHRLRSLHVTFHEMVGMDA
VVTTLSSLDFPMLEHCEFIVPPTNHRYFLSKTSALNFLHHSTPCRFDSLTSIRVQRVPLR
CFSRHTLVNLRKLYLSFPAQGSLLPTDELLRFLTHSPQLEDLTLDDVWLTWAHSSTTTSS
TDPHADSLLDATLPMLHRLTWRAAAAANVSSLMSSLHIPRLQSWDLTVLPASKRNINSHN
FTVPLSQPQGRPPTSDPLEGIHTLSALTDLTVQCHDAEGLKGVLRKFGFPALERLELGFL
DPNPGAKLVLPRADSLFRDPRLPTVTHLTLTDFALEGERAYRRAAGNGHGDGYGSEVEDE
DMAMLRYMPNLVSLTLVSCASAGVLLHELARTCTGGSPAAGPDEGPGVRACPKLEEVTLM
SCQDVSFGDVYRIAHLRSRKPYQGSAAANMNVDGSGSGGVPRSDIHSADPGLSNSNGKEA
AIGDAPPSPDPSALLQRKIVPLRRSLRRAAQNTSNPYHGEVAAQAAVGAGPTPTMMFSMS
EALNPAKLARVYIDDCPLVMKGDAAALEGMGVMVSYS
Download sequence
Identical sequences XP_007773784.1.51617 jgi|Conpu1|146904|estExt_fgenesh1_pg.C_150001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]