SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|146995|estExt_fgenesh1_pg.C_150117 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|146995|estExt_fgenesh1_pg.C_150117
Domain Number - Region: 42-70
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0162
Family Classic zinc finger, C2H2 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|146995|estExt_fgenesh1_pg.C_150117
Sequence length 214
Sequence
MDQASERYKIWCASTEAGDSTISLPLHAAIMAPERKRRPTCECTFGNCQMDFTSTRDARV
HIEGVHLHHRRYSCFCGMYATADPSAIRRHRKTKHSDVAIGSCWLDNDCLVSWGQYCCTF
NNSEASEVTRVDQGQDEWMDDTDGSFQSPNDYQNWGIFYTATYLQASSPNDLPPLSSPPA
APVVPVTGDCGAAQNQPGESLQHSANDFLKTFRF
Download sequence
Identical sequences jgi|Conpu1|146995|estExt_fgenesh1_pg.C_150117 XP_007773915.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]