SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|148066|gm1.57_g from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|148066|gm1.57_g
Domain Number - Region: 24-154
Classification Level Classification E-value
Superfamily Osmotin, thaumatin-like protein 0.0628
Family Osmotin, thaumatin-like protein 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|148066|gm1.57_g
Sequence length 154
Sequence
MFVASVLAVAALAFASGAAAEQHQVTFTNNCGYGTPRFLYQGNGNPQGAATIQGELNGGI
AWLDNGASCSTNGVGCGAVEFTLQNTGYSQADITLEPEGNHNYLYPIGFNFINGCNTGLF
CNNPNCVDQASFSPTQVPLVDCQANDSGINVIFC
Download sequence
Identical sequences jgi|Conpu1|148066|gm1.57_g XP_007762920.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]