SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|148067|gm1.58_g from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|148067|gm1.58_g
Domain Number - Region: 24-124
Classification Level Classification E-value
Superfamily Osmotin, thaumatin-like protein 0.034
Family Osmotin, thaumatin-like protein 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|148067|gm1.58_g
Sequence length 173
Sequence
MSAASVLAVVALAFASASAAEQHQVTLTNDCGYGTPRFLYQGNGSPQGAATIQGELNGGI
AWLDNGALCSTNGVGCGAVEFTLQNTGLSQADITLEPEGNHNYLHPIGFNFINGCNTGLS
CNNPDCVDQASFSSTQVPLVDCEADDSGTSPFAIPRFARVLRGVSQAIGARRF
Download sequence
Identical sequences jgi|Conpu1|148067|gm1.58_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]