SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|148070|gm1.61_g from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|148070|gm1.61_g
Domain Number - Region: 21-122
Classification Level Classification E-value
Superfamily Osmotin, thaumatin-like protein 0.0889
Family Osmotin, thaumatin-like protein 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|148070|gm1.61_g
Sequence length 150
Sequence
MFAIIATAVALASFVAAESHQVTFTNNCGYGTPLFLYQGDSTPQGGTTIQGELNGGIAWL
ENGSCTTDGVNCGAVEFTLQNTGYSQADITLEPEGNHNYLYPIGFNFINGCSNGLFCDNP
NCITVASFSPTQVPLADCQADNCGINVIFC
Download sequence
Identical sequences jgi|Conpu1|148070|gm1.61_g XP_007762923.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]