SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|148330|gm1.321_g from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|148330|gm1.321_g
Domain Number 1 Region: 1-147
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.000000000052
Family C5 cytosine-specific DNA methylase, DCM 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|148330|gm1.321_g
Sequence length 148
Sequence
MKCIEFYSGICGLHIALKGSRIPNAQLIKAYDWDQSACQVYTTNHGPSIVSRTDISRLTA
GELAALGVDIWLALLPVDHGPESESEPREARSTRGHKVPFTTSMMCFRFHDSATRTHLVD
ALARLGYTTAEFFLAPVQFGILNSLLRY
Download sequence
Identical sequences jgi|Conpu1|148330|gm1.321_g XP_007763121.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]