SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|150775|gm1.2766_g from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|150775|gm1.2766_g
Domain Number 1 Region: 96-163
Classification Level Classification E-value
Superfamily Cyanase C-terminal domain 1.26e-27
Family Cyanase C-terminal domain 0.00024
Further Details:      
 
Domain Number 2 Region: 14-91
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000484
Family Cyanase N-terminal domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|150775|gm1.2766_g
Sequence length 163
Sequence
MSQQATVASNTRPYSDLPPICAQFFEAKARSGKTFADIGKAIGRDEVWVASAFYAQAKLE
KSDIEALSKELGINSVAIQAELGEHWWPDRGLGPAPPSDPVLYRLYEGVMVYGRPIKAII
HEKFGDGIMSMIDCKVTVDRKPDPKGDRVQLLFDGKFLPYSKW
Download sequence
Identical sequences jgi|Conpu1|150775|gm1.2766_g XP_007765632.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]