SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|150926|gm1.2917_g from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|150926|gm1.2917_g
Domain Number 1 Region: 405-432
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000147
Family Ran binding protein zinc finger-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|150926|gm1.2917_g
Sequence length 443
Sequence
MVHVRINERETNPNQHINFISVLSVGNADSESEARTLMRALAAQVRPVMKQHGFTVNSFE
EYEYNKVFAGRNWNAGENVEIVLRTAHGSFAPLSYLMSTLCHELAHIKHMNHSPAFHALW
RQLNSEVRALQNRGYFGDGYWSSGQRLADSARVSGEGVSSGDFPEYVCGGAHTKSRSSTL
RRRRRAPRGFAGPSVHTGAQTERKRKAGARVTSRAFEAGGQALNEGAEGEEKSAGTGFRK
QAGSKRAREERALAAERRLQALHAGPSRKIDVSMTDEDAENDMELVPETDEDRKQFMLDT
MGAGEDLGALKFSLDDYFRPSRGSVKTEPLSSRGGECDSAPAKKRQRTSNADPGRDDEVK
PSRTQLDLADAISRNSSSARVKSEEEELVRIASTNPKTSSTQRERNPPWACNICTLENNP
GHLACSVCGTPKGETTWAGSDHT
Download sequence
Identical sequences jgi|Conpu1|150926|gm1.2917_g XP_007765737.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]