SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|151262|gm1.3253_g from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|151262|gm1.3253_g
Domain Number 1 Region: 1-149
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 2.75e-24
Family ThuA-like 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|151262|gm1.3253_g
Sequence length 149
Sequence
MPANVLLYWATAGYVHDSIPDSREAIKSRPLEVNNIPVVFEDTDDKSWFTDETLEKYDAI
VFLNNSGYGILDDTGKAALQKWINLGGNFVGIHCAADALRDTPFFGRQLGAYFHYHPKIS
EATVKVVDANHPSTKPLPKNGSWTLVDEM
Download sequence
Identical sequences XP_007765987.1.51617 jgi|Conpu1|151262|gm1.3253_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]