SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|151279|gm1.3270_g from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|151279|gm1.3270_g
Domain Number 1 Region: 21-224
Classification Level Classification E-value
Superfamily Osmotin, thaumatin-like protein 2.88e-17
Family Osmotin, thaumatin-like protein 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|151279|gm1.3270_g
Sequence length 231
Sequence
MSAFRALSIAAIAAVASAQSVNVVNKCSDAVTLFTQSSFGTIDNNVNVAAGATNDMHISS
DWDGAINVGTGCNGNTCTTGGPTWDGQTPFSRAEFNFNAVPGSVTYDISLIYGYNVGMEI
SSADSGCSAFACTLPSGCPVTGPDNSCFSPCCSSSDACSGGALPASNGGCVSNAGPGPNS
PFYYKSCTNAYAFPDNDGAAGYTPADNVDFTCGNTAITLTLCPGTTSNIPK
Download sequence
Identical sequences jgi|Conpu1|151279|gm1.3270_g XP_007765999.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]