SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|151721|gm1.3712_g from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|151721|gm1.3712_g
Domain Number 1 Region: 41-242
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 1.83e-23
Family Class I glutamine amidotransferases (GAT) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|151721|gm1.3712_g
Sequence length 279
Sequence
MAEQVHVRAAVLACATFTDKFVQQFGDYGVITSRFLMDHTPPGLTCDLDVFNVNLKEYPV
SIQDYDGLIITGSPYSVYDQEEWIKVLIDFLKGVRQRHPRVKMIGICFGHQAIATAFGHS
VALGEWELYPVPVKVNGLGRRIFGDKSILTFPQLHRDQVWPALPESTATLERYPYCPFQV
WGSSELAANQGMILVDDTRYRESDAGRVLHSKIDIFTIQGHPEFTRPMAFELIAFLEGFG
YLDADLAKTMRSKQTDDNDSGIVAKVIWNVLLGSRMIPR
Download sequence
Identical sequences jgi|Conpu1|151721|gm1.3712_g XP_007766665.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]