SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|152652|gm1.4643_g from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|152652|gm1.4643_g
Domain Number - Region: 26-48
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0797
Family Classic zinc finger, C2H2 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|152652|gm1.4643_g
Sequence length 52
Sequence
MNSKKGSTNNKPSGNTSSPPNPPGISYKCSKCTSTFPSLDEKDKHEGGFHNV
Download sequence
Identical sequences XP_007767625.1.51617 jgi|Conpu1|152652|gm1.4643_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]