SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|152664|gm1.4655_g from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|152664|gm1.4655_g
Domain Number 1 Region: 420-855
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.43e-84
Family Serine carboxypeptidase-like 0.00013
Further Details:      
 
Domain Number 2 Region: 11-144,173-212
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 4.59e-26
Family Class I glutamine amidotransferases (GAT) 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|152664|gm1.4655_g
Sequence length 860
Sequence
MVRAQEKQDIAVGILALQGAFAEHQVALQKLPIPRKVSVVLVRTPEDLDRSLLARLAGLL
EPLRLFLKQKPIWGTCAGAILLAQAVENTKKGGQELIGGMSVTVARNGWGSQVESFEALL
YVDGLRDAEQSFTGVFIRAPVVLSMNPKPDDAPMEILARLPASVLPKGQTLVSPDEDDTD
PRDTRTVVAIRQGKHMLTTFHPELTKDNRFHEPTSCHLVRVPTPFLSPSPIRQHQDTSPT
GALLITPNPAHPMWSLSGPPVRIEAPALVREASPHAHLDKVRAIWTILAHARMSACIRAL
VGWAANQILHKNAPMLSYIAADQQRSLSSYLQASIQRSTEMRLTVSTLLSAAILGALSAT
GTSARTLRPDEVRARQADAARQFEANARSARAAANGTASGVKNITFTNPRASDFYVDGAT
LPLVDFDLGPSWAGLLPISNETDETRQLYFWFFPPGPEGSLDDIIFWTNGGPGCSSLEGV
LQENGPLTWSWGQAHATPNEHSWTNLSSVLWVEQPVGTGFSQGTPNIKNEDELAAQLVGF
MQQFLEVFGELKGKKLYLTGESYAGTYVPYIANYIYENPDLLDLSLQGIWVSDPSLSWDV
VQEQIPAVDFVNRYAGLFSFNLPRTAKPTRPPSMPKPSSATTLATSKNTSHTHPRGPLPL
PGTSVEADPGCDVWDDIFNNALITNPAFDIYRIWDTYPILWDVLGFPGSFPQQQSPIYFN
RPDVKAAIHAPPNVTWAECSNVNVFPDGDGSLPPAFTVLPNVIEKSQRSVIVHGLADFIL
IAEGTRIVIQNMTWNGLQGFQTPIENDTFIVDGVGAFGQMHSERGLTYFEVILSGHMVPQ
FSPVAAFQIMQYLMGFRDSP
Download sequence
Identical sequences jgi|Conpu1|152664|gm1.4655_g XP_007767645.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]